SUN1 anticorps

N° du produit ABIN634826

L’anticorps Lapin Polyclonal anti-SUN1 a été validé pour WB. Il convient pour détecter SUN1 dans des échantillons de Humain, Rat et Souris.

Aperçu rapide pour SUN1 anticorps (ABIN634826)

Antigène: SUN1 (Sad1 and UNC84 Domain Containing 1 (SUN1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SUN1 anticorps

Purification: Affinity purified

Immunogène: UNC84 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UNC84A Blocking Peptide, (ABIN5616913), is also available for use as a blocking control in assays to test for specificity of this UNC84A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SUN1

Antigène: SUN1 (Sad1 and UNC84 Domain Containing 1 (SUN1))

Autre désignation: UNC84A

Sujet: This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described, however, the full-length nature of some of these variants has not been determined.

Poids moléculaire: 78 kDa (MW of target protein)

Pathways: Maintenance of Protein Location