SUN1 anticorps

N° du produit ABIN634826

Détail du produit anti-SUN1 anticorps

Antigène: SUN1 (Sad1 and UNC84 Domain Containing 1 (SUN1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUN1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: UNC84 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UNC84A Blocking Peptide, catalog no. 33R-7492, is also available for use as a blocking control in assays to test for specificity of this UNC84A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SUN1

Antigène: SUN1 (Sad1 and UNC84 Domain Containing 1 (SUN1))

Autre désignation: UNC84A (SUN1 Produits)

Synonymes: anticorps UNC84A, anticorps 4632417G13Rik, anticorps 5730434D03Rik, anticorps Unc84a, anticorps mKIAA0810, anticorps Sun domain-containing protein 1, anticorps Sad1 and UNC84 domain containing 1, anticorps sun-1, anticorps SUN1, anticorps Sun1

Sujet: This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described, however, the full-length nature of some of these variants has not been determined.

Poids moléculaire: 78 kDa (MW of target protein)

Pathways: Maintenance of Protein Location