MCTP1 anticorps (Middle Region)

N° du produit ABIN634827

Détail du produit anti-MCTP1 anticorps

Antigène: MCTP1 (Multiple C2 Domains, Transmembrane 1 (MCTP1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCTP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MCTP1 antibody was raised against the middle region of MCTP1

Purification: Affinity purified

Immunogène: MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCTP1 Blocking Peptide, catalog no. 33R-5550, is also available for use as a blocking control in assays to test for specificity of this MCTP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCTP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCTP1

Antigène: MCTP1 (Multiple C2 Domains, Transmembrane 1 (MCTP1))

Autre désignation: MCTP1 (MCTP1 Produits)

Synonymes: anticorps MGC157203, anticorps MGC108303, anticorps 2810465F10Rik, anticorps Mctp1-ps1, anticorps RGD1305199, anticorps multiple C2 and transmembrane domain containing 1, anticorps multiple C2 domains, transmembrane 1, anticorps MCTP1, anticorps mctp1, anticorps Mctp1

Sujet: MCTP1 belongs to the MCTP family.It contains 3 C2 domains. MCTP1 is a multi-pass membrane protein. It binds calcium via the C2 domains in absence of phospholipids. The function of MCTP1 remains unknown.

Poids moléculaire: 89 kDa (MW of target protein)