CTDNEP1A anticorps

N° du produit ABIN634833

Détail du produit anti-CTDNEP1A anticorps

Antigène: CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CTDNEP1A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DULLARD Blocking Peptide, catalog no. 33R-3807, is also available for use as a blocking control in assays to test for specificity of this DULLARD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DULLARD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CTDNEP1A

Antigène: CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))

Autre désignation: DULLARD (CTDNEP1A Produits)

Synonymes: anticorps Dullard, anticorps 2610507E10Rik, anticorps DULLARD, anticorps HSA011916, anticorps NET56, anticorps dullard, anticorps im:7137489, anticorps wu:fi48e07, anticorps zgc:92207, anticorps ctdnep1, anticorps dullard-b, anticorps net56, anticorps CTD nuclear envelope phosphatase 1, anticorps CTD nuclear envelope phosphatase 1a, anticorps CTD nuclear envelope phosphatase 1 L homeolog, anticorps Ctdnep1, anticorps CTDNEP1, anticorps ctdnep1a, anticorps ctdnep1.L

Sujet: DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.

Poids moléculaire: 28 kDa (MW of target protein)