RNF19A anticorps (N-Term)

N° du produit ABIN634836

Cet anticorps anti-RNF19A est un anticorps Lapin Polyclonal détectant RNF19A dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour RNF19A anticorps (N-Term) (ABIN634836)

Antigène: RNF19A (Ring Finger Protein 19A (RNF19A))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF19A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RNF19A anticorps

Épitope: N-Term

Specificité: RNF19 A antibody was raised against the N terminal of RNF19

Purification: Affinity purified

Immunogène: RNF19 A antibody was raised using the N terminal of RNF19 corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF19A Blocking Peptide, (ABIN939348), is also available for use as a blocking control in assays to test for specificity of this RNF19A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF19A

Antigène: RNF19A (Ring Finger Protein 19A (RNF19A))

Autre désignation: RNF19A

Sujet: RNF19A contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson's disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB.

Poids moléculaire: 91 kDa (MW of target protein)