RNF19A anticorps (N-Term)

N° du produit ABIN634836

Détail du produit anti-RNF19A anticorps

Antigène: RNF19A (Ring Finger Protein 19A (RNF19A))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF19A est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF19 A antibody was raised against the N terminal of RNF19

Purification: Affinity purified

Immunogène: RNF19 A antibody was raised using the N terminal of RNF19 corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF19A Blocking Peptide, catalog no. 33R-3962, is also available for use as a blocking control in assays to test for specificity of this RNF19A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF19A

Antigène: RNF19A (Ring Finger Protein 19A (RNF19A))

Autre désignation: RNF19A (RNF19A Produits)

Synonymes: anticorps RNF19, anticorps RNF19A, anticorps AA032313, anticorps Dorfin, anticorps Rnf19, anticorps UIP117, anticorps Ubce7ip2, anticorps XYbp, anticorps ring finger protein 19A, RBR E3 ubiquitin protein ligase, anticorps ring finger protein 19A, anticorps RNF19A, anticorps Rnf19a

Sujet: RNF19A contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson's disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB.

Poids moléculaire: 91 kDa (MW of target protein)