Seladin 1 anticorps (N-Term)

N° du produit ABIN634838

L’anticorps Lapin Polyclonal anti-Seladin 1 a été validé pour WB. Il convient pour détecter Seladin 1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Seladin 1 anticorps (N-Term) (ABIN634838)

Antigène: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Seladin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Seladin 1 anticorps

Épitope: N-Term

Specificité: DHCR24 antibody was raised against the N terminal of DHCR24

Purification: Affinity purified

Immunogène: DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHCR24 Blocking Peptide, (ABIN938356), is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Seladin 1

Antigène: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Autre désignation: DHCR24

Sujet: DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells.

Poids moléculaire: 58 kDa (MW of target protein)