Arylsulfatase H anticorps (Middle Region)

N° du produit ABIN634839

Détail du produit anti-Arylsulfatase H anticorps

Antigène: Arylsulfatase H (ARSH)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Arylsulfatase H est non-conjugé

Application: Western Blotting (WB)

Specificité: ARSH antibody was raised against the middle region of ARSH

Purification: Affinity purified

Immunogène: ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARSH Blocking Peptide, catalog no. 33R-2924, is also available for use as a blocking control in assays to test for specificity of this ARSH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Arylsulfatase H

Antigène: Arylsulfatase H (ARSH)

Autre désignation: ARSH (ARSH Produits)

Synonymes: anticorps ARSH, anticorps LOC100232370, anticorps sulfatase, anticorps arylsulfatase family member H, anticorps arylsulfatase D, anticorps ARSH, anticorps LOC100232370, anticorps LOC100229427

Sujet: Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.

Poids moléculaire: 63 kDa (MW of target protein)