LMF2 anticorps (Middle Region)

N° du produit ABIN634844

L’anticorps Lapin Polyclonal anti-LMF2 a été validé pour WB. Il convient pour détecter LMF2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour LMF2 anticorps (Middle Region) (ABIN634844)

Antigène: LMF2 (Lipase Maturation Factor 2 (LMF2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LMF2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LMF2 anticorps

Épitope: Middle Region

Specificité: LMF2 antibody was raised against the middle region of LMF2

Purification: Affinity purified

Immunogène: LMF2 antibody was raised using the middle region of LMF2 corresponding to a region with amino acids YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LMF2 Blocking Peptide, (ABIN936252), is also available for use as a blocking control in assays to test for specificity of this LMF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LMF2

Antigène: LMF2 (Lipase Maturation Factor 2 (LMF2))

Autre désignation: LMF2

Sujet: LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.

Poids moléculaire: 77 kDa (MW of target protein)