TMEM135 anticorps (N-Term)

N° du produit ABIN634847

L’anticorps Lapin Polyclonal anti-TMEM135 a été validé pour WB. Il convient pour détecter TMEM135 dans des échantillons de Humain.

Aperçu rapide pour TMEM135 anticorps (N-Term) (ABIN634847)

Antigène: TMEM135 (Transmembrane Protein 135 (TMEM135))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM135 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM135 anticorps

Épitope: N-Term

Specificité: TMEM135 antibody was raised against the N terminal of TMEM135

Purification: Affinity purified

Immunogène: TMEM135 antibody was raised using the N terminal of TMEM135 corresponding to a region with amino acids SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM135 Blocking Peptide, (ABIN5616662), is also available for use as a blocking control in assays to test for specificity of this TMEM135 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM135 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM135

Antigène: TMEM135 (Transmembrane Protein 135 (TMEM135))

Autre désignation: TMEM135

Sujet: TMEM135 protein is part of a conserved genetic network involved in fat storage and longevity regulation.

Poids moléculaire: 52 kDa (MW of target protein)