ABCF3 anticorps

N° du produit ABIN634851

Cet anticorps anti-ABCF3 Polyclonal Lapin (ABIN634851) détecte spécifiquement ABCF3 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ABCF3 anticorps (ABIN634851)

Antigène: ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCF3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ABCF3 anticorps

Purification: Affinity purified

Immunogène: ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCF3 Blocking Peptide, (ABIN937269), is also available for use as a blocking control in assays to test for specificity of this ABCF3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCF3

Antigène: ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))

Autre désignation: ABCF3

Sujet: ABCF3 belongs to the ABC transporter family, EF3 subfamily. It contains 2 ABC transporter domains. The exact function of ABCF3 remains unknown.

Poids moléculaire: 78 kDa (MW of target protein)