ABCF3 anticorps
-
- Antigène Tous les produits ABCF3
- ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCF3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABCF3 Blocking Peptide, catalog no. 33R-1883, is also available for use as a blocking control in assays to test for specificity of this ABCF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))
- Autre désignation
- ABCF3 (ABCF3 Produits)
- Synonymes
- anticorps ABCF3, anticorps DKFZp459M1517, anticorps EST201864, anticorps AI326318, anticorps AU016058, anticorps BB119416, anticorps ATP binding cassette subfamily F member 3, anticorps ATP-binding cassette sub-family F member 3, anticorps ATP-binding cassette, sub-family F (GCN20), member 3, anticorps ABCF3, anticorps CpipJ_CPIJ014150, anticorps PTRG_01254, anticorps PTRG_00878, anticorps VDBG_00967, anticorps MGYG_07201, anticorps Abcf3
- Sujet
- ABCF3 belongs to the ABC transporter family, EF3 subfamily. It contains 2 ABC transporter domains. The exact function of ABCF3 remains unknown.
- Poids moléculaire
- 78 kDa (MW of target protein)
-