STEAP3 anticorps (C-Term)

N° du produit ABIN634853

Détail du produit anti-STEAP3 anticorps

Antigène: STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STEAP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: STEAP3 antibody was raised against the C terminal of STEAP3

Purification: Affinity purified

Immunogène: STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STEAP3 Blocking Peptide, catalog no. 33R-9427, is also available for use as a blocking control in assays to test for specificity of this STEAP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STEAP3

Antigène: STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))

Autre désignation: STEAP3 (STEAP3 Produits)

Synonymes: anticorps STEAP3, anticorps 1010001D01Rik, anticorps Tsap6, anticorps pHyde, anticorps AHMIO2, anticorps STMP3, anticorps TSAP6, anticorps dudlin-2, anticorps STEAP3 metalloreductase, anticorps STEAP family member 3, anticorps STEAP3, anticorps steap3, anticorps Steap3

Sujet: AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis