SLC23A2 anticorps

N° du produit ABIN634854

Cet anticorps anti-SLC23A2 est un anticorps Lapin Polyclonal détectant SLC23A2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour SLC23A2 anticorps (ABIN634854)

Antigène: SLC23A2 (Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC23A2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC23A2 anticorps

Purification: Affinity purified

Immunogène: SLC23 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC23A2 Blocking Peptide, (ABIN5616205), is also available for use as a blocking control in assays to test for specificity of this SLC23A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC23A2

Antigène: SLC23A2 (Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2))

Autre désignation: SLC23A2

Sujet: The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development