PDE3B anticorps (Middle Region)

N° du produit ABIN634856

L’anticorps Lapin Polyclonal anti-PDE3B a été validé pour WB. Il convient pour détecter PDE3B dans des échantillons de Humain.

Aperçu rapide pour PDE3B anticorps (Middle Region) (ABIN634856)

Antigène: PDE3B (phosphodiesterase 3B, CGMP-Inhibited (PDE3B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDE3B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDE3B anticorps

Épitope: Middle Region

Specificité: PDE3 B antibody was raised against the middle region of PDE3

Purification: Affinity purified

Immunogène: PDE3 B antibody was raised using the middle region of PDE3 corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDE3B Blocking Peptide, (ABIN5615273), is also available for use as a blocking control in assays to test for specificity of this PDE3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDE3B

Antigène: PDE3B (phosphodiesterase 3B, CGMP-Inhibited (PDE3B))

Autre désignation: PDE3B

Sujet: PDE3B belongs to the cyclic nucleotide phosphodiesterase family. It may play a role in fat metabolism.

Poids moléculaire: 124 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, cAMP Metabolic Process