Myoferlin anticorps

N° du produit ABIN634863

Détail du produit anti-Myoferlin anticorps

Antigène: Myoferlin (MYOF)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Myoferlin est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FER1 L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FER1L3 Blocking Peptide, catalog no. 33R-7747, is also available for use as a blocking control in assays to test for specificity of this FER1L3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FER0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Myoferlin

Antigène: Myoferlin (MYOF)

Autre désignation: FER1L3 (MYOF Produits)

Synonymes: anticorps FER1L3, anticorps 2310004N10Rik, anticorps 2310051D19Rik, anticorps E030042N20Rik, anticorps Fer1l3, anticorps RGD1564216, anticorps zgc:63504, anticorps fer1l3, anticorps myoferlin, anticorps MYOF, anticorps Myof, anticorps myof, anticorps LOC100380767

Sujet: Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair.

Poids moléculaire: 235 kDa (MW of target protein)