SLC37A4 anticorps

N° du produit ABIN634867

Détail du produit anti-SLC37A4 anticorps

Antigène: SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC37A4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC37 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC37A4 Blocking Peptide, catalog no. 33R-9804, is also available for use as a blocking control in assays to test for specificity of this SLC37A4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC37A4

Antigène: SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))

Autre désignation: SLC37A4 (SLC37A4 Produits)

Synonymes: anticorps G6PT1, anticorps G6PT2, anticorps G6PT3, anticorps GSD1b, anticorps GSD1c, anticorps GSD1d, anticorps TRG-19, anticorps TRG19, anticorps G6PC, anticorps G6PT, anticorps G6pt1, anticorps GSD-1b, anticorps mG6PT, anticorps MGC68695, anticorps g6pt1, anticorps g6pt2, anticorps g6pt3, anticorps gsd1b, anticorps gsd1c, anticorps gsd1d, anticorps trg19, anticorps pro0685, anticorps MGC97640, anticorps slc37a4, anticorps wu:fc25d06, anticorps zgc:77098, anticorps solute carrier family 37 member 4, anticorps solute carrier family 37 (glucose-6-phosphate transporter), member 4, anticorps solute carrier family 37 member 4 L homeolog, anticorps solute carrier family 37 (glucose-6-phosphate transporter), member 4a, anticorps SLC37A4, anticorps Slc37a4, anticorps slc37a4.L, anticorps slc37a4, anticorps slc37a4a

Sujet: SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cellular Glucan Metabolic Process