KLHL31 anticorps

N° du produit ABIN634869

Cet anticorps anti-KLHL31 est un anticorps Lapin Polyclonal détectant KLHL31 dans WB et IHC. Adapté pour Souris, Humain, Chien et Rat.

Aperçu rapide pour KLHL31 anticorps (ABIN634869)

Antigène: KLHL31 (Kelch-Like 31 (KLHL31))

Reactivité: Souris, Humain, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHL31 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-KLHL31 anticorps

Purification: Affinity purified

Immunogène: KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHL31 Blocking Peptide, (ABIN5614381), is also available for use as a blocking control in assays to test for specificity of this KLHL31 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHL31

Antigène: KLHL31 (Kelch-Like 31 (KLHL31))

Autre désignation: KLHL31

Sujet: KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE)

Poids moléculaire: 70 kDa (MW of target protein)