Thymopoietin anticorps (N-Term)

N° du produit ABIN634870

Cet anticorps Lapin Polyclonal détecte spécifiquement Thymopoietin dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Thymopoietin anticorps (N-Term) (ABIN634870)

Antigène: Thymopoietin (TMPO)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Thymopoietin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Thymopoietin anticorps

Épitope: N-Term

Specificité: Thymopoietin antibody was raised against the N terminal of TMPO

Purification: Affinity purified

Immunogène: Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Thymopoietin Blocking Peptide, (ABIN5616594), is also available for use as a blocking control in assays to test for specificity of this Thymopoietin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Thymopoietin

Antigène: Thymopoietin (TMPO)

Autre désignation: Thymopoietin

Sujet: TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.

Poids moléculaire: 39 kDa (MW of target protein)