SEC22C anticorps

N° du produit ABIN634875

Cet anticorps anti-SEC22C est un anticorps Lapin Polyclonal détectant SEC22C dans WB. Adapté pour Humain.

Aperçu rapide pour SEC22C anticorps (ABIN634875)

Antigène: SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SEC22C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SEC22C anticorps

Purification: Affinity purified

Immunogène: SEC22 C antibody was raised using a synthetic peptide corresponding to a region with amino acids FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SEC22C Blocking Peptide, (ABIN938439), is also available for use as a blocking control in assays to test for specificity of this SEC22C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SEC22C

Antigène: SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))

Autre désignation: SEC22C

Sujet: The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking.

Poids moléculaire: 34 kDa (MW of target protein)