MT-ND6 anticorps

N° du produit ABIN634876

Détail du produit anti-MT-ND6 anticorps

Antigène: MT-ND6 (Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MT-ND6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ND6 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ND6 Blocking Peptide, catalog no. 33R-1970, is also available for use as a blocking control in assays to test for specificity of this ND6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ND6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MT-ND6

Antigène: MT-ND6 (Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6))

Autre désignation: ND6 (MT-ND6 Produits)

Synonymes: anticorps MTND6, anticorps NADH6, anticorps mitochondrial NADH-ubiquinone oxidoreductase chain 6, anticorps NADH dehydrogenase, subunit 6 (complex I), anticorps NADH dehydrogenase subunit 6, anticorps NADH dehydrogenasesubunit 6, anticorps mt:ND6, anticorps ND6, anticorps nad6

Sujet: ND6 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Poids moléculaire: 19 kDa (MW of target protein)