Tmc2 anticorps (Middle Region)

N° du produit ABIN634892

Détail du produit anti-Tmc2 anticorps

Antigène: Tmc2 (Transmembrane Channel-Like 2 (Tmc2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tmc2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMC2 antibody was raised against the middle region of TMC2

Purification: Affinity purified

Immunogène: TMC2 antibody was raised using the middle region of TMC2 corresponding to a region with amino acids YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMC2 Blocking Peptide, catalog no. 33R-10062, is also available for use as a blocking control in assays to test for specificity of this TMC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tmc2

Antigène: Tmc2 (Transmembrane Channel-Like 2 (Tmc2))

Autre désignation: TMC2 (Tmc2 Produits)

Synonymes: anticorps C20orf145, anticorps dJ686C3.3, anticorps CWEA2, anticorps transmembrane channel like 2, anticorps transmembrane channel-like 2, anticorps transmembrane channel-like gene family 2, anticorps TMC2, anticorps Tmc2

Sujet: TMC2 is considered a member of transmembrane proteins family. The specific function of this gene is unknown, however, expression in the inner ear suggests that it may be crucial for normal auditory function. This gene is considered a member of a gene family predicted to encode transmembrane proteins.

Poids moléculaire: 102 kDa (MW of target protein)