SLC30A8 anticorps

N° du produit ABIN634898

L’anticorps Lapin Polyclonal anti-SLC30A8 a été validé pour WB. Il convient pour détecter SLC30A8 dans des échantillons de Humain.

Aperçu rapide pour SLC30A8 anticorps (ABIN634898)

Antigène: SLC30A8 (Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC30A8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC30A8 anticorps

Purification: Affinity purified

Immunogène: SLC30 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC30A8 Blocking Peptide, (ABIN940534), is also available for use as a blocking control in assays to test for specificity of this SLC30A8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC30A8

Antigène: SLC30A8 (Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8))

Autre désignation: SLC30A8

Sujet: The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Hormone Transport, Carbohydrate Homeostasis, Transition Metal Ion Homeostasis