DPP6 anticorps (Middle Region)

N° du produit ABIN634901

Détail du produit anti-DPP6 anticorps

Antigène: DPP6 (Dipeptidyl-Peptidase 6 (DPP6))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPP6 est non-conjugé

Application: Western Blotting (WB)

Specificité: DPP6 antibody was raised against the middle region of DPP6

Purification: Affinity purified

Immunogène: DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPP6 Blocking Peptide, catalog no. 33R-2964, is also available for use as a blocking control in assays to test for specificity of this DPP6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPP6

Antigène: DPP6 (Dipeptidyl-Peptidase 6 (DPP6))

Autre désignation: DPP6 (DPP6 Produits)

Sujet: DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.

Poids moléculaire: 91 kDa (MW of target protein)