SLC43A1 anticorps (Middle Region)

N° du produit ABIN634904

L’anticorps Lapin Polyclonal anti-SLC43A1 a été validé pour WB. Il convient pour détecter SLC43A1 dans des échantillons de Humain.

Aperçu rapide pour SLC43A1 anticorps (Middle Region) (ABIN634904)

Antigène: SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC43A1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC43A1 anticorps

Épitope: Middle Region

Specificité: SLC43 A1 antibody was raised against the middle region of SLC43 1

Purification: Affinity purified

Immunogène: SLC43 A1 antibody was raised using the middle region of SLC43 1 corresponding to a region with amino acids AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC43A1 Blocking Peptide, (ABIN936994), is also available for use as a blocking control in assays to test for specificity of this SLC43A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC43A1

Antigène: SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))

Autre désignation: SLC43A1

Sujet: SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.

Poids moléculaire: 61 kDa (MW of target protein)