SLC43A1 anticorps (Middle Region)

N° du produit ABIN634904

Détail du produit anti-SLC43A1 anticorps

Antigène: SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC43A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC43 A1 antibody was raised against the middle region of SLC43 1

Purification: Affinity purified

Immunogène: SLC43 A1 antibody was raised using the middle region of SLC43 1 corresponding to a region with amino acids AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC43A1 Blocking Peptide, catalog no. 33R-1608, is also available for use as a blocking control in assays to test for specificity of this SLC43A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC43A1

Antigène: SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))

Autre désignation: SLC43A1 (SLC43A1 Produits)

Synonymes: anticorps 2610016F07Rik, anticorps AA986141, anticorps Lat3, anticorps PB39, anticorps Pov1, anticorps R00504, anticorps LAT3, anticorps POV1, anticorps fi47a12, anticorps lat3a, anticorps slc43a1, anticorps wu:fi47a12, anticorps zgc:55850, anticorps wu:fa01a01, anticorps zgc:158383, anticorps solute carrier family 43, member 1, anticorps solute carrier family 43 member 1, anticorps solute carrier family 43 (amino acid system L transporter), member 1a, anticorps solute carrier family 43 (amino acid system L transporter), member 1b, anticorps solute carrier family 43 member 1 L homeolog, anticorps Slc43a1, anticorps SLC43A1, anticorps slc43a1a, anticorps slc43a1b, anticorps slc43a1.L

Sujet: SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.

Poids moléculaire: 61 kDa (MW of target protein)