DNAJC25 anticorps
-
- Antigène Tous les produits DNAJC25
- DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DNAJC25 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DNAJC25 Blocking Peptide, catalog no. 33R-7841, is also available for use as a blocking control in assays to test for specificity of this DNAJC25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))
- Autre désignation
- DNAJC25 (DNAJC25 Produits)
- Synonymes
- anticorps bA16L21.2.1, anticorps ERJ7, anticorps GNG10, anticorps dnj2, anticorps dnajc25, anticorps 2010109C08Rik, anticorps 2010203O07Rik, anticorps Dnajc25, anticorps DnaJ heat shock protein family (Hsp40) member C25, anticorps DnaJ heat shock protein family (Hsp40) member C25 S homeolog, anticorps DnaJ (Hsp40) homolog, subfamily C , member 25, anticorps dnaJ homolog subfamily C member 25, anticorps DNAJC25, anticorps dnajc25, anticorps dnajc25.S, anticorps Dnajc25, anticorps LOC100730599
- Sujet
- DNAJC25 may be involved in heat shock protein binding.
- Poids moléculaire
- 42 kDa (MW of target protein)
-