Tricellulin anticorps (Middle Region)

N° du produit ABIN634907

L’anticorps anti-Tricellulin Polyclonal Lapin est utilisé pour la détection de Tricellulin dans des échantillons de Humain et Souris. Il a été validé pour WB.

Aperçu rapide pour Tricellulin anticorps (Middle Region) (ABIN634907)

Antigène: Tricellulin (MARVELD2)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tricellulin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Tricellulin anticorps

Épitope: Middle Region

Specificité: MARVELD2 antibody was raised against the middle region of MARVELD2

Purification: Affinity purified

Immunogène: MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MARVELD2 Blocking Peptide, (ABIN5614673), is also available for use as a blocking control in assays to test for specificity of this MARVELD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tricellulin

Antigène: Tricellulin (MARVELD2)

Autre désignation: MARVELD2

Sujet: Tight junctions (TJ) prevent leakage of solutes through the paracellular pathway of epithelial cells. MARVELD2, or tricellulin (TRIC), is an integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Cell-Cell Junction Organization