Occludin anticorps (N-Term)

N° du produit ABIN634908

Détail du produit anti-Occludin anticorps

Antigène: Occludin (OCLN)

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Occludin est non-conjugé

Application: Western Blotting (WB)

Specificité: Occludin antibody was raised against the N terminal of OCLN

Purification: Affinity purified

Immunogène: Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Occludin Blocking Peptide, catalog no. 33R-9782, is also available for use as a blocking control in assays to test for specificity of this Occludin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCLN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Occludin

Antigène: Occludin (OCLN)

Autre désignation: Occludin (OCLN Produits)

Synonymes: anticorps AI503564, anticorps Ocl, anticorps ocln, anticorps oclnb, anticorps tpmt, anticorps OCLN, anticorps wu:fd23h10, anticorps wu:fi13c01, anticorps zgc:113992, anticorps zgc:56359, anticorps BLCPMG, anticorps occludin, anticorps occludin S homeolog, anticorps occludin a, anticorps Ocln, anticorps OCLN, anticorps ocln.S, anticorps ocln, anticorps oclna

Sujet: OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C