TSPAN4 anticorps (Middle Region)

N° du produit ABIN634910

Détail du produit anti-TSPAN4 anticorps

Antigène: TSPAN4 (Tetraspanin 4 (TSPAN4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSPAN4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tetraspanin 4 antibody was raised against the middle region of TSPAN4

Purification: Affinity purified

Immunogène: Tetraspanin 4 antibody was raised using the middle region of TSPAN4 corresponding to a region with amino acids YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 4 Blocking Peptide, catalog no. 33R-10258, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSPAN4

Antigène: TSPAN4 (Tetraspanin 4 (TSPAN4))

Autre désignation: Tetraspanin 4 (TSPAN4 Produits)

Synonymes: anticorps tspan-4, anticorps DKFZp469K0233, anticorps NAG-2, anticorps NAG2, anticorps TETRASPAN, anticorps TM4SF7, anticorps TSPAN-4, anticorps AI325509, anticorps AI746565, anticorps D130042I01Rik, anticorps Tm4sf7, anticorps Tspan-4, anticorps tetraspanin 4, anticorps tetraspanin 4 S homeolog, anticorps uncharacterized LOC724310, anticorps TSPAN4, anticorps tspan4.S, anticorps tspan4, anticorps LOC724310, anticorps Tspan4

Sujet: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified.

Poids moléculaire: 26 kDa (MW of target protein)