FAM20C anticorps (Middle Region)

N° du produit ABIN634925

L’anticorps anti-FAM20C Polyclonal Lapin est utilisé pour la détection de FAM20C dans des échantillons de Humain, Rat et Souris. Il a été validé pour WB.

Aperçu rapide pour FAM20C anticorps (Middle Region) (ABIN634925)

Antigène: FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM20C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM20C anticorps

Épitope: Middle Region

Specificité: FAM20 C antibody was raised against the middle region of FAM20

Purification: Affinity purified

Immunogène: FAM20 C antibody was raised using the middle region of FAM20 corresponding to a region with amino acids CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM20C Blocking Peptide, (ABIN937075), is also available for use as a blocking control in assays to test for specificity of this FAM20C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM20C

Antigène: FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))

Autre désignation: FAM20C

Sujet: FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.

Poids moléculaire: 66 kDa (MW of target protein)