MMP24 anticorps

N° du produit ABIN634930

Détail du produit anti-MMP24 anticorps

Antigène: MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP24 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MMP24 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMP24 Blocking Peptide, catalog no. 33R-3551, is also available for use as a blocking control in assays to test for specificity of this MMP24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMP24

Antigène: MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))

Autre désignation: MMP24 (MMP24 Produits)

Synonymes: anticorps MMP-24, anticorps MMP25, anticorps MT-MMP 5, anticorps MT-MMP5, anticorps MT5-MMP, anticorps MT5MMP, anticorps MTMMP5, anticorps AU040325, anticorps Mt5-mmp, anticorps si:ch211-239j9.5, anticorps MMP24, anticorps mt3-mmp, anticorps matrix metallopeptidase 24, anticorps matrix metallopeptidase 16 S homeolog, anticorps MMP24, anticorps Mmp24, anticorps mmp24, anticorps mmp16.S

Sujet: This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.

Poids moléculaire: 57 kDa (MW of target protein)