PLGRKT anticorps (Middle Region)
-
- Antigène Voir toutes PLGRKT Anticorps
- PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLGRKT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C9 ORF46 antibody was raised against the middle region of C9 rf46
- Purification
- Affinity purified
- Immunogène
- C9 ORF46 antibody was raised using the middle region of C9 rf46 corresponding to a region with amino acids AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL
- Top Product
- Discover our top product PLGRKT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C9ORF46 Blocking Peptide, catalog no. 33R-1270, is also available for use as a blocking control in assays to test for specificity of this C9ORF46 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF46 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))
- Autre désignation
- C9ORF46 (PLGRKT Produits)
- Synonymes
- anticorps C9orf46, anticorps MDS030, anticorps PLG-RKT, anticorps Plg-R(KT), anticorps RGD1306839, anticorps 1110007H22Rik, anticorps 5033414D02Rik, anticorps AI852040, anticorps Plg-RKT, anticorps plasminogen receptor with a C-terminal lysine, anticorps plasminogen receptor, C-terminal lysine transmembrane protein, anticorps PLGRKT, anticorps Plgrkt
- Sujet
- The function of C9orf46 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 17 kDa (MW of target protein)
-