CMTM8 anticorps (Middle Region)

N° du produit ABIN634936

Détail du produit anti-CMTM8 anticorps

Antigène: CMTM8 (CKLF-Like MARVEL Transmembrane Domain Containing 8 (CMTM8))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CMTM8 est non-conjugé

Application: Western Blotting (WB)

Specificité: CMTM8 antibody was raised against the middle region of CMTM8

Purification: Affinity purified

Immunogène: CMTM8 antibody was raised using the middle region of CMTM8 corresponding to a region with amino acids CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CMTM8 Blocking Peptide, catalog no. 33R-1686, is also available for use as a blocking control in assays to test for specificity of this CMTM8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMTM8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CMTM8

Antigène: CMTM8 (CKLF-Like MARVEL Transmembrane Domain Containing 8 (CMTM8))

Autre désignation: CMTM8 (CMTM8 Produits)

Synonymes: anticorps MGC82744, anticorps marveld1, anticorps CKLFSF8, anticorps CKLFSF8-V2, anticorps 2700018N07Rik, anticorps AA408515, anticorps Cklfsf8, anticorps CKLF-like MARVEL transmembrane domain containing 8 L homeolog, anticorps CKLF like MARVEL transmembrane domain containing 8, anticorps CKLF-like MARVEL transmembrane domain containing 8, anticorps cmtm8.L, anticorps CMTM8, anticorps cmtm8, anticorps Cmtm8

Sujet: Cmtm8 gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.

Poids moléculaire: 19 kDa (MW of target protein)