POMT2 anticorps (Middle Region)

N° du produit ABIN634940

L’anticorps Lapin Polyclonal anti-POMT2 a été validé pour WB. Il convient pour détecter POMT2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour POMT2 anticorps (Middle Region) (ABIN634940)

Antigène: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POMT2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-POMT2 anticorps

Épitope: Middle Region

Specificité: POMT2 antibody was raised against the middle region of POMT2

Purification: Affinity purified

Immunogène: POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POMT2 Blocking Peptide, (ABIN5615470), is also available for use as a blocking control in assays to test for specificity of this POMT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POMT2

Antigène: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Autre désignation: POMT2

Sujet: POMT2 encodes an integral membrane protein of the endoplasmic reticulum (ER) that shares significant sequence similarity with a family of protein O-mannosyltransferases of S.cerevisiae.

Poids moléculaire: 84 kDa (MW of target protein)