IMPAD1 anticorps (N-Term)

N° du produit ABIN634943

Détail du produit anti-IMPAD1 anticorps

Antigène: IMPAD1 (Inositol Monophosphatase Domain Containing 1 (IMPAD1))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IMPAD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: IMPAD1 antibody was raised against the N terminal of IMPAD1

Purification: Affinity purified

Immunogène: IMPAD1 antibody was raised using the N terminal of IMPAD1 corresponding to a region with amino acids VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IMPAD1 Blocking Peptide, catalog no. 33R-9642, is also available for use as a blocking control in assays to test for specificity of this IMPAD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPAD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IMPAD1

Antigène: IMPAD1 (Inositol Monophosphatase Domain Containing 1 (IMPAD1))

Autre désignation: IMPAD1 (IMPAD1 Produits)

Synonymes: anticorps IMP 3, anticorps RGD1306455, anticorps gPAPP, anticorps impa3, anticorps 1110001C20Rik, anticorps AA408880, anticorps AI451589, anticorps AL022796, anticorps B230207P20, anticorps Jaws, anticorps GPAPP, anticorps IMP-3, anticorps IMPA3, anticorps IMPase 3, anticorps zgc:123256, anticorps inositol monophosphatase domain containing 1, anticorps inositol monophosphatase domain containing 1 S homeolog, anticorps Impad1, anticorps impad1.S, anticorps IMPAD1, anticorps impad1

Sujet: The function of IMPAD protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process