TMEM30A anticorps (N-Term)

N° du produit ABIN634944

Cet anticorps anti-TMEM30A est un anticorps Lapin Polyclonal détectant TMEM30A dans WB et IHC. Adapté pour Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour TMEM30A anticorps (N-Term) (ABIN634944)

Antigène: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM30A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-TMEM30A anticorps

Épitope: N-Term

Specificité: TMEM30 A antibody was raised against the N terminal of TMEM30

Purification: Affinity purified

Immunogène: TMEM30 A antibody was raised using the N terminal of TMEM30 corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM30A Blocking Peptide, (ABIN938480), is also available for use as a blocking control in assays to test for specificity of this TMEM30A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM30A

Antigène: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Autre désignation: TMEM30A

Sujet: The function of TMEM30A protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 41 kDa (MW of target protein)