MFF anticorps (C-Term)

N° du produit ABIN634945

Cet anticorps Lapin Polyclonal détecte spécifiquement MFF dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour MFF anticorps (C-Term) (ABIN634945)

Antigène: MFF (Mitochondrial Fission Factor (MFF))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MFF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MFF anticorps

Épitope: C-Term

Specificité: C2 ORF33 antibody was raised against the C terminal Of C2 rf33

Purification: Affinity purified

Immunogène: C2 ORF33 antibody was raised using the C terminal Of C2 rf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C2ORF33 Blocking Peptide, (ABIN5612504), is also available for use as a blocking control in assays to test for specificity of this C2ORF33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MFF

Antigène: MFF (Mitochondrial Fission Factor (MFF))

Autre désignation: C2ORF33

Sujet: C2orf33 plays a role in mitochondrial and peroxisomal fission.

Poids moléculaire: 38 kDa (MW of target protein)