IL22 Receptor alpha 1 anticorps (Middle Region)

N° du produit ABIN634946

Détail du produit anti-IL22 Receptor alpha 1 anticorps

Antigène: IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL22 Receptor alpha 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: IL22 R alpha 1 antibody was raised against the middle region of IL22 A1

Purification: Affinity purified

Immunogène: IL22 R alpha 1 antibody was raised using the middle region of IL22 A1 corresponding to a region with amino acids YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL22R alpha 1 Blocking Peptide, catalog no. 33R-10235, is also available for use as a blocking control in assays to test for specificity of this IL22R alpha 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL22 Receptor alpha 1

Antigène: IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))

Autre désignation: IL22R alpha 1 (IL22RA1 Produits)

Synonymes: anticorps IL22RA1, anticorps CRF2-9, anticorps IL22R, anticorps IL22R1, anticorps 9130219A07Rik, anticorps ENSMUSG00000073746, anticorps IL-22R, anticorps Il22r, anticorps RGD1559655, anticorps interleukin 22 receptor subunit alpha 1, anticorps interleukin 22 receptor, alpha 1, anticorps IL22RA1, anticorps Il22ra1

Sujet: IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4).

Poids moléculaire: 63 kDa (MW of target protein)