PAQR6 anticorps (N-Term)

N° du produit ABIN634948

Cet anticorps Lapin Polyclonal détecte spécifiquement PAQR6 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour PAQR6 anticorps (N-Term) (ABIN634948)

Antigène: PAQR6 (Progestin and AdipoQ Receptor Family Member VI (PAQR6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAQR6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PAQR6 anticorps

Épitope: N-Term

Specificité: PAQR6 antibody was raised against the N terminal of PAQR6

Purification: Affinity purified

Immunogène: PAQR6 antibody was raised using the N terminal of PAQR6 corresponding to a region with amino acids PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAQR6 Blocking Peptide, (ABIN5615214), is also available for use as a blocking control in assays to test for specificity of this PAQR6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAQR6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAQR6

Antigène: PAQR6 (Progestin and AdipoQ Receptor Family Member VI (PAQR6))

Autre désignation: PAQR6

Sujet: This protein mediates receptor activity.

Poids moléculaire: 39 kDa (MW of target protein)