TMEM163 anticorps (Middle Region)

N° du produit ABIN634949

L’anticorps Lapin Polyclonal anti-TMEM163 a été validé pour WB. Il convient pour détecter TMEM163 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TMEM163 anticorps (Middle Region) (ABIN634949)

Antigène: TMEM163 (Transmembrane Protein 163 (TMEM163))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM163 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM163 anticorps

Épitope: Middle Region

Specificité: TMEM163 antibody was raised against the middle region of TMEM163

Purification: Affinity purified

Immunogène: TMEM163 antibody was raised using the middle region of TMEM163 corresponding to a region with amino acids AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM163 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM163 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM163 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM163

Antigène: TMEM163 (Transmembrane Protein 163 (TMEM163))

Autre désignation: TMEM163

Sujet: The function of TMEM163 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 31 kDa (MW of target protein)