ABHD13 anticorps (C-Term)

N° du produit ABIN634950

Détail du produit anti-ABHD13 anticorps

Antigène: ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABHD13 est non-conjugé

Application: Western Blotting (WB)

Specificité: ABHD13 antibody was raised against the C terminal of ABHD13

Purification: Affinity purified

Immunogène: ABHD13 antibody was raised using the C terminal of ABHD13 corresponding to a region with amino acids LAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABHD13 Blocking Peptide, catalog no. 33R-4775, is also available for use as a blocking control in assays to test for specificity of this ABHD13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABHD13

Antigène: ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))

Autre désignation: ABHD13 (ABHD13 Produits)

Synonymes: anticorps BEM46L1, anticorps C13orf6, anticorps RP11-153I24.2, anticorps bA153I24.2, anticorps 1110065L07Rik, anticorps AI463703, anticorps AI788994, anticorps RGD1308317, anticorps zgc:123286, anticorps abhydrolase domain containing 13, anticorps abhydrolase domain containing 13 S homeolog, anticorps ABHD13, anticorps abhd13, anticorps abhd13.S, anticorps Abhd13

Sujet: ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.

Poids moléculaire: 38 kDa (MW of target protein)