NrCAM anticorps (N-Term)
-
- Antigène Voir toutes NrCAM (NRCAM) Anticorps
- NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))
-
Épitope
- N-Term
-
Reactivité
- Souris, Humain, Rat, Chien, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NrCAM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NRCAM antibody was raised against the N terminal of NRCAM
- Purification
- Affinity purified
- Immunogène
- NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK
- Top Product
- Discover our top product NRCAM Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NRCAM Blocking Peptide, catalog no. 33R-7194, is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRCAM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))
- Autre désignation
- NRCAM (NRCAM Produits)
- Synonymes
- anticorps CD56, anticorps MSK39, anticorps NCAM, anticorps Bravo, anticorps C030017F07Rik, anticorps C130076O07Rik, anticorps mKIAA0343, anticorps NRCAM, anticorps si:dkey-240a12.1, anticorps Nr-CAM, anticorps neural cell adhesion molecule 1, anticorps neuronal cell adhesion molecule, anticorps neuronal cell adhesion molecule L homeolog, anticorps neuronal cell adhesion molecule a, anticorps NCAM1, anticorps NRCAM, anticorps Nrcam, anticorps nrcam.L, anticorps nrcama, anticorps nrcam
- Sujet
- Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.
- Poids moléculaire
- 84 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-