MARVELD3 anticorps (Middle Region)

N° du produit ABIN634967

L’anticorps Lapin Polyclonal anti-MARVELD3 a été validé pour WB et IHC. Il convient pour détecter MARVELD3 dans des échantillons de Humain, Souris et Chien.

Aperçu rapide pour MARVELD3 anticorps (Middle Region) (ABIN634967)

Antigène: MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MARVELD3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-MARVELD3 anticorps

Épitope: Middle Region

Specificité: MARVELD3 antibody was raised against the middle region of MARVELD3

Purification: Affinity purified

Immunogène: MARVELD3 antibody was raised using the middle region of MARVELD3 corresponding to a region with amino acids SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MARVELD3 Blocking Peptide, (ABIN5614674), is also available for use as a blocking control in assays to test for specificity of this MARVELD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MARVELD3

Antigène: MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))

Autre désignation: MARVELD3

Sujet: MARVELD3 is involved in membrane apposition and fusion events.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization