TREML2 anticorps (Middle Region)

N° du produit ABIN634968

Détail du produit anti-TREML2 anticorps

Antigène: TREML2 (Triggering Receptor Expressed On Myeloid Cells-Like 2 (TREML2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TREML2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TREML2 antibody was raised against the middle region of TREML2

Purification: Affinity purified

Immunogène: TREML2 antibody was raised using the middle region of TREML2 corresponding to a region with amino acids TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TREML2 Blocking Peptide, catalog no. 33R-9100, is also available for use as a blocking control in assays to test for specificity of this TREML2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TREML2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TREML2

Antigène: TREML2 (Triggering Receptor Expressed On Myeloid Cells-Like 2 (TREML2))

Autre désignation: TREML2 (TREML2 Produits)

Synonymes: anticorps TREM-B2V1, anticorps C6orf76, anticorps TLT-2, anticorps TLT2, anticorps dJ238O23.1, anticorps AW049306, anticorps Gm750, anticorps Tlt2, anticorps triggering receptor expressed on myeloid cells like 2, anticorps triggering receptor expressed on myeloid cells-like 2, anticorps TREML2, anticorps Treml2

Sujet: TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties.

Poids moléculaire: 41 kDa (MW of target protein)