SLC25A36 anticorps (N-Term)

N° du produit ABIN634972

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC25A36 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SLC25A36 anticorps (N-Term) (ABIN634972)

Antigène: SLC25A36 (Solute Carrier Family 25, Member 36 (SLC25A36))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A36 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC25A36 anticorps

Épitope: N-Term

Specificité: SLC25 A36 antibody was raised against the N terminal of SLC25 36

Purification: Affinity purified

Immunogène: SLC25 A36 antibody was raised using the N terminal of SLC25 36 corresponding to a region with amino acids SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A36 Blocking Peptide, (ABIN5616223), is also available for use as a blocking control in assays to test for specificity of this SLC25A36 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A36

Antigène: SLC25A36 (Solute Carrier Family 25, Member 36 (SLC25A36))

Autre désignation: SLC25A36

Sujet: SLC25A36 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. SLC25A36 is a multi-pass membrane protein. The function of the SLC25A36 protein remains unknown.

Poids moléculaire: 34 kDa (MW of target protein)