LRRN3 anticorps (N-Term)
-
- Antigène Voir toutes LRRN3 Anticorps
- LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRRN3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LRRN3 antibody was raised against the N terminal of LRRN3
- Purification
- Affinity purified
- Immunogène
- LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL
- Top Product
- Discover our top product LRRN3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRRN3 Blocking Peptide, catalog no. 33R-2582, is also available for use as a blocking control in assays to test for specificity of this LRRN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))
- Autre désignation
- LRRN3 (LRRN3 Produits)
- Synonymes
- anticorps nlrr3, anticorps nlrr-3, anticorps MGC146637, anticorps FIGLER5, anticorps NLRR-3, anticorps NLRR3, anticorps Nlrr3, anticorps leucine rich repeat neuronal 3, anticorps leucine rich repeat protein 3, neuronal, anticorps LRRN3, anticorps lrrn3, anticorps Lrrn3
- Sujet
- LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown.
- Poids moléculaire
- 79 kDa (MW of target protein)
-