CKLF anticorps (N-Term)

N° du produit ABIN634980

Cet anticorps anti-CKLF est un anticorps Lapin Polyclonal détectant CKLF dans WB. Adapté pour Humain.

Aperçu rapide pour CKLF anticorps (N-Term) (ABIN634980)

Antigène: CKLF (Chemokine-Like Factor (CKLF))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CKLF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CKLF anticorps

Épitope: N-Term

Specificité: CKLF antibody was raised against the N terminal of CKLF

Purification: Affinity purified

Immunogène: CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CKLF Blocking Peptide, (ABIN5612902), is also available for use as a blocking control in assays to test for specificity of this CKLF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKLF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CKLF

Antigène: CKLF (Chemokine-Like Factor (CKLF))

Autre désignation: CKLF

Sujet: CKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle.

Poids moléculaire: 13 kDa (MW of target protein)