GGT7 anticorps (C-Term)

N° du produit ABIN634986

Détail du produit anti-GGT7 anticorps

Antigène: GGT7 (gamma-Glutamyltransferase 7 (GGT7))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GGT7 est non-conjugé

Application: Western Blotting (WB)

Specificité: GGTL3 antibody was raised against the C terminal Of Ggtl3

Purification: Affinity purified

Immunogène: GGTL3 antibody was raised using the C terminal Of Ggtl3 corresponding to a region with amino acids ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GGTL3 Blocking Peptide, catalog no. 33R-4055, is also available for use as a blocking control in assays to test for specificity of this GGTL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGTL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GGT7

Antigène: GGT7 (gamma-Glutamyltransferase 7 (GGT7))

Autre désignation: GGTL3 (GGT7 Produits)

Synonymes: anticorps D20S101, anticorps GGT4, anticorps GGTL3, anticorps GGTL5, anticorps dJ18C9.2, anticorps 1110017C11Rik, anticorps 6330563L03Rik, anticorps Ggtl3, anticorps gamma-glutamyltransferase 7, anticorps GGT7, anticorps Ggt7

Sujet: GGTL3 is an enzyme involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. GGTL3 consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis.

Poids moléculaire: 70 kDa (MW of target protein)