ATG9A anticorps

N° du produit ABIN634988

Détail du produit anti-ATG9A anticorps

Antigène: ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATG9A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ATG9 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATG9A Blocking Peptide, catalog no. 33R-9437, is also available for use as a blocking control in assays to test for specificity of this ATG9A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATG9A

Antigène: ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))

Autre désignation: ATG9A (ATG9A Produits)

Synonymes: anticorps ATG9, anticorps ATG9A, anticorps zgc:158700, anticorps APG9L1, anticorps DKFZp459N117, anticorps MGD3208, anticorps mATG9, anticorps AU019532, anticorps Apg9l1, anticorps Atg9, anticorps Atg9l1, anticorps RGD1310450, anticorps autophagy related 9A, anticorps ATG9 autophagy related 9 homolog A (S. cerevisiae), anticorps ATG9A, anticorps atg9a, anticorps Atg9a

Sujet: ATG9A belongs to the ATG9 family. It plays a role in autophagy.

Poids moléculaire: 94 kDa (MW of target protein)